PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC17554_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 257aa    MW: 29997 Da    PI: 5.3096
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC17554_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.82.9e-213694356
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
     Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56
                 +R+++t+eq+++Lee +++ +r+p++e+++++A+kl    +++ ++V++WFqN++ +e+
  RrC17554_p1 36 SRWNPTPEQITALEEIYRRgTRTPTTEQIQQIAAKLrkygRIEGKNVFYWFQNHKSRER 94
                 7*****************99*************************************98 PP

2Wus_type_Homeobox113.41.2e-363496264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       a++RW+PtpeQi+ Lee+y++G+rtP++e+iq+i+a+L++yG+ie+kNVfyWFQN+k+Rer k
        RrC17554_p1 34 ASSRWNPTPEQITALEEIYRRGTRTPTTEQIQQIAAKLRKYGRIEGKNVFYWFQNHKSRERLK 96
                       689**********************************************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.26E-133194IPR009057Homeodomain-like
PROSITE profilePS5007111.3863196IPR001356Homeobox domain
SMARTSM003898.4E-633100IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.3E-93694IPR009057Homeodomain-like
PfamPF000467.2E-193694IPR001356Homeobox domain
CDDcd000867.62E-63794No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0016049Biological Processcell growth
GO:0048314Biological Processembryo sac morphogenesis
GO:0048446Biological Processpetal morphogenesis
GO:0048482Biological Processplant ovule morphogenesis
GO:0051301Biological Processcell division
GO:0048353Cellular Componentprimary endosperm nucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGWEKSHWAN GNIIDNDHNH QLIVGSEDNS PAAASSRWNP TPEQITALEE IYRRGTRTPT  60
TEQIQQIAAK LRKYGRIEGK NVFYWFQNHK SRERLKRRRC EGDCDLNNAH EPLKDFKDSS  120
SGGYRADQPK SCPSTPHKTP QPLQNELVLA NQVNNEESEW ASDEGKEATW RNLVASFVNQ  180
EPGEINIEED KCNVSGEVQE EEEVEEEETR EIRTLNLFPV LENQEKTEWF AEKKKTKANR  240
MCYNYRYYHE FIPPKKN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013714194.11e-132PREDICTED: WUSCHEL-related homeobox 6-like
SwissprotQ9ZVF58e-76WOX6_ARATH; WUSCHEL-related homeobox 6
TrEMBLA0A078HTT11e-133A0A078HTT1_BRANA; BnaA09g18650D protein
STRINGBra017448.1-P1e-112(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133691828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01500.12e-73WOX family protein